PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G353553_P01
Common NameLOC100193071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 397aa    MW: 42318 Da    PI: 8.2798
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G353553_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.11e-09252310563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  +a l +++
  GRMZM2G353553_P01 252 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSAGLATQN 310
                        999*********************************************99998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-16248312IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.691250313IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-10252303No hitNo description
Gene3DG3DSA:1.20.5.1702.0E-10252309No hitNo description
PfamPF001703.3E-9252310IPR004827Basic-leucine zipper domain
CDDcd147035.76E-22253304No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MNTTNGHGLM HHHHVQASMA PAQHQKQRPG LPPPAPAPAG AGSHSLHADM CVDDSSAPGR  60
AQALGGLPPR KAHRRSRSDV VPYGYFQPLP PPSPSPKVEA GGWGLASGGG GGAGDDLLNA  120
YMSMEGMDGL NHSDGDSRGS SGMRTNGADS SENESEDYGA GADSQFFLWG DGGKRRRNAS  180
GEPAAPPAAA AAAARHARSH SMDSLMGKLS FSANGEPGKF SLDFGGGEFT PAEMKRIMAD  240
EKLAEMALAD PKRVKRVLAN RQSAARSKER RMRYIAELEQ KVQILQTEAT TLSAQLTLLQ  300
RDSAGLATQN NELKFRLQAM EQQAQLRDAL NEALTGEVQR LKLGDTASSG NNLPQQVQLR  360
CQNQVAGLHK QQQQQGGEQI PFYQLEQNGA PRNDAPK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.176450.0ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G353553
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G353553_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352290.0BT035229.1 Zea mays full-length cDNA clone ZM_BFb0046N14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001131709.10.0putative bZIP transcription factor superfamily protein
TrEMBLB4FDP10.0B4FDP1_MAIZE; Uncharacterized protein
TrEMBLK4JFG30.0K4JFG3_MAIZE; BZIP-type transcription factor (Fragment)
STRINGGRMZM2G353553_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.35e-60bZIP family protein